PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_68284.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family NAC
Protein Properties Length: 299aa    MW: 33292.8 Da    PI: 7.1647
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_68284.1genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM180.83.5e-5651301128
           NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkg 97 
                   lppGfrFhPtdeel+++yL +kv++  +++ ++i++vd++k+ePwdLp+k++ +ekewyfFs rd+ky+tg r+nrat+sgyWk+tgkdke+++ +g
  MLOC_68284.1   5 LPPGFRFHPTDEELITYYLSRKVSDFAFST-RAIADVDLNKCEPWDLPSKASMGEKEWYFFSMRDRKYPTGIRTNRATESGYWKTTGKDKEIFH-GG 99 
                   79*************************999.89***************999999****************************************.** PP

           NAM  98 elvglkktLvfykgrapkgektdWvmheyrl 128
                   +lvg+kktLvfy grapkgekt+Wvmheyr+
  MLOC_68284.1 100 RLVGMKKTLVFYGGRAPKGEKTSWVMHEYRI 130
                   *****************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.83E-643151IPR003441NAC domain
PROSITE profilePS5100560.3235151IPR003441NAC domain
PfamPF023652.4E-296130IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 299 aa     Download sequence    Send to blast
MEEGLPPGFR FHPTDEELIT YYLSRKVSDF AFSTRAIADV DLNKCEPWDL PSKASMGEKE  60
WYFFSMRDRK YPTGIRTNRA TESGYWKTTG KDKEIFHGGR LVGMKKTLVF YGGRAPKGEK  120
TSWVMHEYRI QNKFPYKPNK EEWVVCRVFK KSQILKLRHP QDSPDMDSPC NDAHASLGEL  180
GEIDVSSMLG GFAPAGPNAS GDNFGHRIDM GAYMNWLAAA NQGAAAMLPW AAAAAPGLLG  240
TVFSANPAMQ KALAPFAGCS QLPRDVGGDT LFGNAMAKVD MECEQPPQLE MHESTWRTF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B6e-57515117165NAC domain-containing protein 19
4dul_A6e-57515117165NAC domain-containing protein 19
1ut7_B6e-57515117165NO APICAL MERISTEM PROTEIN
1ut7_A6e-57515117165NO APICAL MERISTEM PROTEIN
1ut4_B6e-57515117165NO APICAL MERISTEM PROTEIN
1ut4_A6e-57515117165NO APICAL MERISTEM PROTEIN
3swp_D6e-57515220169NAC domain-containing protein 19
3swp_C6e-57515220169NAC domain-containing protein 19
3swp_B6e-57515220169NAC domain-containing protein 19
3swp_A6e-57515220169NAC domain-containing protein 19
3swm_D6e-57515220169NAC domain-containing protein 19
3swm_C6e-57515220169NAC domain-containing protein 19
3swm_B6e-57515220169NAC domain-containing protein 19
3swm_A6e-57515220169NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00364DAPTransfer from AT3G18400Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3631710.0AK363171.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2013D22.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003562269.11e-179PREDICTED: protein CUP-SHAPED COTYLEDON 1-like
SwissprotO040172e-78NAC98_ARATH; Protein CUP-SHAPED COTYLEDON 2
TrEMBLF2DH040.0F2DH04_HORVD; Predicted protein
STRINGMLOC_68284.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP79193450
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18400.17e-94NAC domain containing protein 58